PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID evm.model.supercontig_72.18
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Caricaceae; Carica
Family WRKY
Protein Properties Length: 216aa    MW: 24870.8 Da    PI: 8.2481
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
evm.model.supercontig_72.18genomeASGPBView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY102.62.2e-32139197159
                                  ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
                         WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                                  ldDgy+WrKYGqK+vk++++prsYYrCt+ +C+vkk+ver aedp++v++tYeg+H h+
  evm.model.supercontig_72.18 139 LDDGYKWRKYGQKVVKNTQHPRSYYRCTQDNCRVKKRVERLAEDPRMVITTYEGRHVHS 197
                                  59********************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.801.7E-33124197IPR003657WRKY domain
SuperFamilySSF1182901.28E-28131198IPR003657WRKY domain
PROSITE profilePS5081129.356134199IPR003657WRKY domain
SMARTSM007749.8E-37139198IPR003657WRKY domain
PfamPF031063.1E-25140196IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:1901141Biological Processregulation of lignin biosynthetic process
GO:1904369Biological Processpositive regulation of sclerenchyma cell differentiation
GO:0001046Molecular Functioncore promoter sequence-specific DNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 216 aa     Download sequence    Send to blast
MSSCSQGMVR QGLLEEEAFF SFPPQNLTFP PLTPSHQSLN TSFTLPILSN PQTLLSSSPK  60
HTQRLLSLQR STANLTWAWG EGNIECSKSN NHHGDDDDDD DDDHHHLGVS AMKMKKIKAR  120
RKVREPRFCF KTMSDVDVLD DGYKWRKYGQ KVVKNTQHPR SYYRCTQDNC RVKKRVERLA  180
EDPRMVITTY EGRHVHSPSH DLEDSQAPSH LNFFW*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A7e-27130196874Probable WRKY transcription factor 4
2lex_A7e-27130196874Probable WRKY transcription factor 4
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002279024.14e-95PREDICTED: probable WRKY transcription factor 13
SwissprotQ9SVB76e-65WRK13_ARATH; Probable WRKY transcription factor 13
TrEMBLD7SW854e-95D7SW85_VITVI; Putative uncharacterized protein
TrEMBLI0AVQ14e-95I0AVQ1_9R
STRINGVIT_07s0031g01840.t011e-94(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM61062746
Representative plantOGRP1417875
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G39410.13e-54WRKY DNA-binding protein 13